PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_24105-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 340aa    MW: 36174.1 Da    PI: 9.7919
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_24105-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-1499143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
  TRIUR3_24105-P1  99 PWTEEEHRTFLAGLEKLGKGDWRGIAKNFVTTRTPTQVASHAQKY 143
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.96892148IPR017930Myb domain
SuperFamilySSF466891.22E-1793148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-1895147IPR006447Myb domain, plants
SMARTSM007171.4E-1196146IPR001005SANT/Myb domain
CDDcd001672.82E-1099144No hitNo description
PfamPF002492.0E-1299143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-1299142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MPQDSRPPGM RLFGVTIAPA PAPQLDPPDG DRDPSPNPPV AAREDVMRKC KSMGNLAALA  60
SACPSGDAGG AGDGYLSDGG LLQSSGKRRR AQERKKAVPW TEEEHRTFLA GLEKLGKGDW  120
RGIAKNFVTT RTPTQVASHA QKYFLRQTNP NKKKRRSSLF DMMASDLSPA PNCPILPPTM  180
AKFHDMVTMT NQLQNSSLEG VSSSNAANLA KQVTRDLPPP VPSFTATNVD GSLSKMNHMD  240
CFSRVPSLFR PIPIVPEGTP PSAPATANTS ALTFEANLTS CTSAFLIPKS GPSPLPPATA  300
AKTDHAAENK DLELTVGLPS QQNMTNNISS RNAVGVIQVV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151155KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519470.0JF951947.1 Triticum aestivum clone TaMYB64 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972854.11e-157PREDICTED: uncharacterized protein LOC101753432 isoform X1
TrEMBLM7ZA860.0M7ZA86_TRIUA; Transcription factor MYB1R1
STRINGMLOC_73122.21e-167(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58583652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-37MYB_related family protein